PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI08G12880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 224aa    MW: 25763.2 Da    PI: 8.9868
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI08G12880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.31.5e-26959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     kri+n + rqvtfskRr g++KKA ELS+LCdaev + +fsstg+ly+++s
  OMERI08G12880.1  9 KRIDNATSRQVTFSKRRSGLFKKARELSILCDAEVGLFVFSSTGRLYDFAS 59
                     79***********************************************86 PP

2K-box83.93.5e-2881170998
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      +++++a+ +qqe+a L+++++nLq+ +R+llG++L+ L++++Lq+Le++Le slk+iR +K++++++qi+el +k   +++en++L+kk+
  OMERI08G12880.1  81 NASSEAKLWQQEAASLRQQLHNLQEYHRQLLGQQLSGLDVEDLQNLESRLEMSLKNIRLRKDNVMMDQIQELSRKGSLIHQENMELHKKV 170
                      6788999*********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.408161IPR002100Transcription factor, MADS-box
SMARTSM004329.1E-41160IPR002100Transcription factor, MADS-box
CDDcd002652.14E-44278No hitNo description
SuperFamilySSF554553.27E-32290IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014864.7E-2683170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.38286176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MGRGKIEIKR IDNATSRQVT FSKRRSGLFK KARELSILCD AEVGLFVFSS TGRLYDFAST  60
SMKSIIERYN ETKEDPHQTM NASSEAKLWQ QEAASLRQQL HNLQEYHRQL LGQQLSGLDV  120
EDLQNLESRL EMSLKNIRLR KDNVMMDQIQ ELSRKGSLIH QENMELHKKV GLVHQENINL  180
QKKVYKTKSN GHPTGSTIQH SFLTTDNEIG PNLELSLPEN VEKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-22179178Myocyte-specific enhancer factor 2B
1tqe_Q3e-22179178Myocyte-specific enhancer factor 2B
1tqe_R3e-22179178Myocyte-specific enhancer factor 2B
1tqe_S3e-22179178Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3452200.0AY345220.1 Oryza sativa (japonica cultivar-group) transcription factor MADS23 mRNA, complete cds; alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650847.11e-161PREDICTED: MADS-box transcription factor 23 isoform X3
SwissprotQ6VAM41e-110MAD23_ORYSJ; MADS-box transcription factor 23
TrEMBLA0A0E0ELT71e-165A0A0E0ELT7_9ORYZ; Uncharacterized protein
STRINGOB08G23110.11e-147(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-87AGAMOUS-like 21